ZSCAN4C Rabbit polyclonal antibody

Größe

£152.00

SKU:: A10205
Zusätzliche Namen:: Gm397|XM_142517|ZSCAN4C|Zscan4d
Anwendung:: ELISA, WB
Molekulargewicht:: 57kda
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: CSRMFKHARSLSSHQRTHLNKKSELLCVTCQKMFKRVSDRRTHEIIHMPEKPFKCSTCEKSFSHKTNLKSHEMIHTGEMPYVCSLCSRRFRQSSTYHRHLRNYHRSD
Synonyme:: Gm397;XM_142517;zinc finger and SCAN domain containing protein 4C;zinc finger and SCAN domain-containing protein 4;zinc finger protein 494;ZNF494;Zscan4d
Weitere Details:: Predicted to enable DNA-binding transcription factor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Acts upstream of or within negative regulation of mitotic recombination; regulation of transcription by RNA polymerase II; and telomere maintenance via telomere lengthening. Located in chromosome, telomeric region; cytoplasm; and nucleus. Is expressed in 1-cell stage embryo; 2-cell stage embryo; primary oocyte; and secondary oocyte. Orthologous to human ZSCAN4 (zinc finger and SCAN domain containing 4).