A10190
IARS Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A10190
- Zusätzliche Namen:
- GRIDHH|IARS|ILERS|ILRS|IRS|PRO0785
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 144kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- SAPSLINSSSTLLCQYINLQLLNAKPQECLMGTVGTLLLENPLGQNGLTHQGLLYEAAKVFGLRSRKLKLFLNETQTQEITEDIPVKTLNMKTVYVSVLPTTADF
- Uniprot:
- P41252
- Synonyme:
- GRIDHH;IARS;ILERS;ILRS;IRS;isoleucine tRNA ligase 1, cytoplasmic;isoleucine--tRNA ligase, cytoplasmic;Isoleucyl-tRNA synthetase;PRO0785
- Weitere Details:
- Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAS, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Isoleucine-tRNA synthetase belongs to the class-I aminoacyl-tRNA synthetase family and has been identified as a target of autoantibodies in the autoimmune disease polymyositis/dermatomyositis. Alternatively spliced transcript variants have been found.
- Versandbedingungen:
- Blue Ice