HRH4 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A10151
Zusätzliche Namen:: AXOR35|BG26|GPCR105|GPRv53|H4|H4R|HH4R|HRH4
Anwendung:: ELISA, WB
Molekulargewicht:: 44kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: NMNIYWSLWKRDHLSRCQSHPGLTAVSSNICGHSFRGRLSSRRSLSASTEVPASFHSERQRRKSSLMFSSRTKMNSNTIASKMGSFSQSDSVALHQREHVELLRARRLAKS
Uniprot:: Q9H3N8
Synonyme:: AXOR35;BG26;G-protein coupled receptor 105;GPCR105;GPRv53;H4;H4R;HH4R;histamine H4 receptor;pfi-013;SP9144
Weitere Details:: Histamine is a ubiquitous messenger molecule released from mast cells, enterochromaffin-like cells, and neurons. Its various actions are mediated by a family of histamine receptors, which are a subset of the G-protein coupled receptor superfamily. This gene encodes a histamine receptor that is predominantly expressed in haematopoietic cells. The protein is thought to play a role in inflammation and allergy reponses. Multiple transcript variants encoding different isoforms have been found for this gene.