TRPM4 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A10146
Zusätzliche Namen:: EKVP6|hTRPM4|LTrpC4|PFHB1B|TRPM4|TRPM4B
Anwendung:: ELISA, WB
Molekulargewicht:: 134kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MVVPEKEQSWIPKIFKKKTCTTFIVDSTDPGGTLCQCGRPRTAHPAVAMEDAFGAAVVTVWDSDAHTTEKPTDAYGELDFTGAGRKHSNFLRLSDRTDPAAVYSLVTRTWGFRAPNLVVSVLGGSGGPVLQTWLQDLLRRGLVRAAQSTGAWIVTGGLHTGIGRHVGVAVRDHQMASTGGTKVVAMGVAPWGVVRNRDTLINPKGSFPARYRWRGDPEDGVQFPLDYNYSAFFLVDDGTH
Uniprot:: Q8TD43
Synonyme:: calcium-activated non-selective cation channel 1;EKVP6;hTRPM4;long transient receptor potential channel 4;LTrpC4;melastatin-4;PFHB1B;transient receptor potential cation channel subfamily M member 4;TRPM4B
Weitere Details:: The protein encoded by this gene is a calcium-activated nonselective ion channel that mediates transport of monovalent cations across membranes, thereby depolarizing the membrane. The activity of the encoded protein increases with increasing intracellular calcium concentration, but this channel does not transport calcium.