TXNL4A Rabbit polyclonal antibody

Größe

£152.00

SKU:: A10138
Zusätzliche Namen:: BMKS|DIB1|DIM1|SNRNP15|TXNL4|TXNL4A|U5-15kD
Anwendung:: ELISA, WB
Molekulargewicht:: 13kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKYRY
Uniprot:: P83876
Synonyme:: BMKS;DIB1;DIM1;DIM1 protein homolog;SNRNP15;spliceosomal U5 snRNP-specific 15 kDa protein;thioredoxin-like 4;thioredoxin-like protein 4A;thioredoxin-like U5 snRNP protein U5-15kD;TXNL4;U5-15kD
Weitere Details:: The protein encoded by this gene is a member of the U5 small ribonucleoprotein particle (snRNP), and is involved in pre-mRNA splicing. This protein contains a thioredoxin-like fold and it is expected to interact with multiple proteins. Protein-protein interactions have been observed with the polyglutamine tract-binding protein 1 (PQBP1). Mutations in both the coding region and promoter region of this gene have been associated with Burn-McKeown syndrome, which is a rare disorder characterized by craniofacial dysmorphisms, cardiac defects, hearing loss, and bilateral choanal atresia. A pseudogene of this gene is found on chromosome 2. Alternative splicing results in multiple transcript variants.

Versandbedingungen:: Blue Ice