AP1M1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A10129
Zusätzliche Namen:: AP1M1|AP47|CLAPM2|CLTNM|MU-1A|mu1A
Anwendung:: ELISA, WB
Molekulargewicht:: 49kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MSASAVYVLDLKGKVLICRNYRGDVDMSEVEHFMPILMEKEEEGMLSPILAHGGVRFMWIKHNNLYLVATSKKNACVSLVFSFLYKVVQVFSEYFKELEEESIRDNFVIIYELLDELMDFGYPQTTDSKILQEYITQEGHKLETGAPRPPATVTNAVSWR
Uniprot:: Q9BXS5
Synonyme:: adapter-related protein complex 1 subunit mu-1;adaptor protein complex AP-1 mu-1 subunit;adaptor protein complex AP-1 subunit mu-1;adaptor related protein complex 1 mu 1 subunit;Adaptor-related protein complex 1 subunit mu-1;AP-1 complex subunit mu-1;AP-mu chain family member mu1A;AP47;CLAPM2;clathrin adaptor protein AP47;clathrin assembly protein complex 1 medium chain 1;clathrin assembly protein complex 1 mu-1 medium chain 1;clathrin assembly protein complex 1, medium chain;clathrin assembly protein complex AP1, mu subunit;clathrin coat assembly protein AP47;clathrin coat-associated protein AP47;CLTNM;golgi adaptor AP-1 47 kDa protein;golgi adaptor HA1/AP1 adaptin mu-1 subunit;HA1 47 kDa subunit;MU-1A;mu-adaptin 1;mu1A;mu1A-adaptin
Weitere Details:: The protein encoded by this gene is the medium chain of the trans-Golgi network clathrin-associated protein complex AP-1. The other components of this complex are beta-prime-adaptin, gamma-adaptin, and the small chain AP1S1. This complex is located at the Golgi vesicle and links clathrin to receptors in coated vesicles. These vesicles are involved in endocytosis and Golgi processing. Alternatively spliced transcript variants encoding distinct protein isoforms have been found for this gene.

Versandbedingungen:: Blue Ice