A10126
ZP2 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A10126
- Zusätzliche Namen:
- OOMD6|OZEMA6|Zp-2|ZP2|ZPA
- Anwendung:
- ELISA, WB, IF
- Molekulargewicht:
- 68kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- KMTVSLPGPILLLSDDSSFRGVGSSDLKASGSSGEKSRSETGEEVGSRGAMDTKGHKTAGDVGSKAVAAVAAFAGVVATLGFIYYLYEKRTVSNH
- Uniprot:
- Q05996
- Synonyme:
- OOMD6;Zona pellucida glycoprotein 2;zona pellucida glycoprotein 2 (sperm receptor);zona pellucida glycoprotein ZP2;zona pellucida protein A;zona pellucida sperm-binding protein 2;Zp-2;ZPA
- Weitere Details:
- The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed of three glycoproteins with various functions during fertilization and preimplantation development. The glycosylated mature peptide is one of the structural components of the zona pellucida and functions in secondary binding and penetration of acrosome-reacted spermatozoa. Female mice lacking this gene do not form a stable zona matrix and are sterile. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice







