ZP2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A10126
Zusätzliche Namen:: OOMD6|OZEMA6|Zp-2|ZP2|ZPA
Anwendung:: ELISA, WB, IF
Molekulargewicht:: 68kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: KMTVSLPGPILLLSDDSSFRGVGSSDLKASGSSGEKSRSETGEEVGSRGAMDTKGHKTAGDVGSKAVAAVAAFAGVVATLGFIYYLYEKRTVSNH
Uniprot:: Q05996
Synonyme:: OOMD6;Zona pellucida glycoprotein 2;zona pellucida glycoprotein 2 (sperm receptor);zona pellucida glycoprotein ZP2;zona pellucida protein A;zona pellucida sperm-binding protein 2;Zp-2;ZPA
Weitere Details:: The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed of three glycoproteins with various functions during fertilization and preimplantation development. The glycosylated mature peptide is one of the structural components of the zona pellucida and functions in secondary binding and penetration of acrosome-reacted spermatozoa. Female mice lacking this gene do not form a stable zona matrix and are sterile. Alternative splicing results in multiple transcript variants.