A Alpha-Smooth Muscle Actin (ACTA2) Rabbit polyclonal antibody

Größe

£152.00

SKU:: A1011
Zusätzliche Namen:: ACTSA|A Alpha-Smooth Muscle Actin (ACTA2)
Anwendung:: ELISA, WB, IHC-P, IF
Molekulargewicht:: 42 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQI
Uniprot:: P62736
Synonyme:: actin, alpha 2, smooth muscle, aorta;actin, aortic smooth muscle;ACTSA;Alpha-actin-2;alpha-cardiac actin;cell growth-inhibiting gene 46 protein
Weitere Details:: This gene encodes one of six different actin proteins. Actins are highly conserved proteins that are involved in cell motility, structure, integrity, and intercellular signaling. The encoded protein is a smooth muscle actin that is involved in vascular contractility and blood pressure homeostasis. Mutations in this gene cause a variety of vascular diseases, such as thoracic aortic disease, coronary artery disease, stroke, and Moyamoya disease, as well as multisystemic smooth muscle dysfunction syndrome.