ATP4B Rabbit polyclonal antibody

Größe

£152.00

SKU:: A10106
Zusätzliche Namen:: ATP4B|ATP6B
Anwendung:: ELISA, WB
Molekulargewicht:: 35kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LMQTVDPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPHDPYEGKVEFKLKIEK
Uniprot:: P51164
Synonyme:: ATP6B;ATPase H+/K+ transporting beta subunit;ATPase, H+/K+ exchanging, beta polypeptide;ATPase, H+/K+ transporting, beta polypeptide;gastric H(+)/K(+) ATPase subunit beta;gastric H+/K+ ATPase beta subunit;gastric hydrogen-potassium ATPase, beta;potassium-transporting ATPase beta chain;potassium-transporting ATPase subunit beta;proton pump beta chain
Weitere Details:: The protein encoded by this gene belongs to a family of P-type cation-transporting ATPases. The gastric H+, K+-ATPase is a heterodimer consisting of a high molecular weight catalytic alpha subunit and a smaller but heavily glycosylated beta subunit. This enzyme is a proton pump that catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. It is also responsible for gastric acid secretion. This gene encodes the beta subunit of the gastric H+, K+-ATPase.

Versandbedingungen:: Blue Ice