A10082
IFNLR1 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A10082
- Zusätzliche Namen:
- CRF2/12|IFNLR|IFNLR1|IL-28R1|IL28RA|LICR2
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 53kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- RPRLAPPQNVTLLSQNFSVYLTWLPGLGNPQDVTYFVAYQSSPTRRRWREVEECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLFEVEPAPPVLVLTQTEEILSANATYQLPPCMPPLDLKYEVAFWKEGAGNKTLFPVTPHGQPVQITLQPAASEHHCLSARTIYTFSVPKYSKFSKPTCFLLEVPEANWA
- Uniprot:
- Q8IU57
- Synonyme:
- class II cytokine receptor CRF2/12;CRF2-12;CRF2/12;cytokine receptor class-II member 12;cytokine receptor family 2 member 12;IFN-lambda receptor 1;IFN-lambda-R1;IFNLR;IL-28 receptor subunit alpha;IL-28R-alpha;IL-28R1;IL-28RA;IL28RA;interferon lambda receptor 1;interleukin 28 alpha receptor;interleukin 28 receptor A;interleukin 28 receptor, alpha (interferon, lambda receptor);interleukin or cytokine receptor 2;interleukin-28 receptor subunit alpha;LICR2;likely interleukin or cytokine receptor 2
- Weitere Details:
- The protein encoded by this gene belongs to the class II cytokine receptor family. This protein forms a receptor complex with interleukine 10 receptor, beta (IL10RB). The receptor complex has been shown to interact with three closely related cytokines, including interleukin 28A (IL28A), interleukin 28B (IL28B), and interleukin 29 (IL29). The expression of all three cytokines can be induced by viral infection. The cells overexpressing this protein have been found to have enhanced responses to IL28A and IL29, but decreased response to IL28B. Three alternatively spliced transcript variants encoding distinct isoforms have been reported.
- Versandbedingungen:
- Blue Ice

