GRIN2D Rabbit polyclonal antibody

Größe

£152.00

SKU:: A10080
Zusätzliche Namen:: DEE46|EB11|EIEE46|GluN2D|GRIN2D|NMDAR2D|NR2D
Anwendung:: ELISA, WB
Molekulargewicht:: 170kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: GAQALLRDYGFLPELGHDCRAQNRTHRGESLHRYFMNITWDNRDYSFNEDGFLVNPSLVVISLTRDRTWEVVGSWEQQTLRLKYPLWSRYGRFLQPVDDTQHLTVATLEERPFVIVEPADPISGTCIRDSVPCRSQLNRTHSPPPDAPRPE
Uniprot:: O15399
Synonyme:: DEE46;EB11;EIEE46;estrogen receptor binding CpG island;GluN2D;glutamate [NMDA] receptor subunit epsilon-4;glutamate receptor ionotropic, NMDA 2D;glutamate receptor, ionotropic, N-methyl D-aspartate 2D;N-methyl D-aspartate receptor subtype 2D;N-methyl-d-aspartate receptor subunit 2D;NMDAR2D;NR2D
Weitere Details:: N-methyl-D-aspartate (NMDA) receptors are a class of ionotropic glutamate receptors. NMDA channel has been shown to be involved in long-term potentiation, an activity-dependent increase in the efficiency of synaptic transmission thought to underlie certain kinds of memory and learning. NMDA receptor channels are heteromers composed of the key receptor subunit NMDAR1 (GRIN1) and 1 or more of the 4 NMDAR2 subunits: NMDAR2A (GRIN2A), NMDAR2B (GRIN2B), NMDAR2C (GRIN2C), and NMDAR2D (GRIN2D).