PIAS1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A1007
Zusätzliche Namen:: DDXBP1|GBP|GU/RH-II|PIAS1|ZMIZ3
Anwendung:: ELISA, WB
Molekulargewicht:: 76kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MADSAELKQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKELYRRRFPQKIMTPADLSIPNVHSSPMPATLSPSTIPQLTYDGHPASSPLLPVSLLGPKHELELPHLTSALHPVHPDIKLQK
Uniprot:: O75925
Synonyme:: AR interacting protein;DDXBP1;DEAD/H (Asp-Glu-Ala-Asp/His) box binding protein 1;DEAD/H box-binding protein 1;E3 SUMO-protein ligase PIAS1;E3 SUMO-protein transferase PIAS1;GBP;gu-binding protein;GU/RH-II;protein inhibitor of activated STAT protein 1;RNA helicase II-binding protein;zinc finger, MIZ-type containing 3;ZMIZ3
Weitere Details:: This gene encodes a member of the protein inhibitor of activated STAT (PIAS) family. PIAS proteins function as SUMO E3 ligases and play important roles in many cellular processes by mediating the sumoylation of target proteins. This protein plays a central role as a transcriptional coregulator of numerous cellular pathways includign the STAT1 and nuclear factor kappaB pathways. Alternate splicing results in multiple transcript variants.