A10057
CHRNE Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A10057
- Zusätzliche Namen:
- ACHRE|CHRNE|CMS1A1|CMS1D|CMS1E|CMS2A|CMS4A|CMS4B|CMS4C|FCCMS|FIM1|FIMG|FIMG1|MGI|SCCMS
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 45kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- KNEELRLYHHLFNNYDPGSRPVREPEDTVTISLKVTLTNLISLNEKEETLTTSVWIGIDWQDYRLNYSKDDFGGIETLRVPSELVWLPEIVLENNIDGQFGVAYDANVLVYEGGSVTWLPPAIYRSVCAVEVTYFPFDWQNCSLIFRSQTYNAEEVEFTFAVDNDGKTINKIDIDTEAYTENGEWAIDFCPGVIRRHHGGATDGPGETDVIYSLIIRRK
- Uniprot:
- Q04844
- Synonyme:
- acetylcholine receptor subunit epsilon;acetylcholine receptor, nicotinic, epsilon (muscle);AchR epsilon subunit;ACHRE;cholinergic receptor, nicotinic epsilon;cholinergic receptor, nicotinic, epsilon (muscle);cholinergic receptor, nicotinic, epsilon polypeptide;CMS1D;CMS1E;CMS2A;CMS4A;CMS4B;CMS4C;FCCMS;SCCMS
- Weitere Details:
- Acetylcholine receptors at mature mammalian neuromuscular junctions are pentameric protein complexes composed of four subunits in the ratio of two alpha subunits to one beta, one epsilon, and one delta subunit. The acetylcholine receptor changes subunit composition shortly after birth when the epsilon subunit replaces the gamma subunit seen in embryonic receptors. Mutations in the epsilon subunit are associated with congenital myasthenic syndrome.
- Versandbedingungen:
- Blue Ice