A10014
CACNG1 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A10014
- Zusätzliche Namen:
- CACNG1|CACNLG
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 23kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- DHWAVLSPHMEHHNTTCEAAHFGLWRICTKRIPMDDSKTCGPITLPGEKNCSYFRHFNPGESSEIFEFTTQKEYSISAAAI
- Uniprot:
- Q06432
- Synonyme:
- CACNLG;calcium channel, voltage-dependent, gamma subunit 1;dihydropyridine-sensitive L-type, skeletal muscle calcium channel subunit gamma;L-type calcium channel gamma polypeptide;neuronal dihydropyridine-sensitive calcium channel gamma subunit;voltage-dependent calcium channel gamma-1 subunit
- Weitere Details:
- Voltage-dependent calcium channels are composed of five subunits. The protein encoded by this gene represents one of these subunits, gamma, and is one of two known gamma subunit proteins. This particular gamma subunit is part of skeletal muscle 1,4-dihydropyridine-sensitive calcium channels and is an integral membrane protein that plays a role in excitation-contraction coupling. This gene is part of a functionally diverse eight-member protein subfamily of the PMP-22/EMP/MP20 family and is located in a cluster with two family members that function as transmembrane AMPA receptor regulatory proteins (TARPs).
- Versandbedingungen:
- Blue Ice