A0993
PPIA Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A0993
- Zusätzliche Namen:
- CYPA|CYPH|HEL-S-69p|PPIA
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 17kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
- Uniprot:
- P62937
- Synonyme:
- Cyclophilin A;cyclosporin A-binding protein;CYPA;CYPH;epididymis secretory sperm binding protein Li 69p;HEL-S-69p;peptidyl-prolyl cis-trans isomerase A;peptidylprolyl isomerase A (cyclophilin A);PPIase A;rotamase A;T cell cyclophilin
- Weitere Details:
- This gene encodes a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. The encoded protein is a cyclosporin binding-protein and may play a role in cyclosporin A-mediated immunosuppression. The protein can also interact with several HIV proteins, including p55 gag, Vpr, and capsid protein, and has been shown to be necessary for the formation of infectious HIV virions. Multiple pseudogenes that map to different chromosomes have been reported.
- Versandbedingungen:
- Blue Ice

