A0982
PI3 Kinase p110 beta Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A0982
- Zusätzliche Namen:
- P110BETA|PI3 Kinase p110 beta|PI3K|PI3KBETA|PIK3C1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 110kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- KVKTKKSTKTINPSKYQTIRKAGKVHYPVAWVNTMVFDFKGQLRTGDIILHSWSSFPDELEEMLNPMGTVQTNPYTENATALHVKFPENKKQPYYYPPFDKIIEKAAEIASSDSANVSSRGGKKFLPVLKEILDRDPLSQLCENEMDLIWTLRQDCREIFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPK
- Uniprot:
- P42338
- Synonyme:
- P110BETA;phosphatidylinositol 4,5-bisphosphate 3-kinase 110 kDa catalytic subunit beta;phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform;phosphoinositide-3-kinase, catalytic, beta polypeptide;PI3-kinase p110 subunit beta;PI3-kinase subunit beta;PI3K;PI3K-beta;PI3KBETA;PIK3C1;PtdIns-3-kinase p110;ptdIns-3-kinase subunit beta;ptdIns-3-kinase subunit p110-beta
- Weitere Details:
- This gene encodes an isoform of the catalytic subunit of phosphoinositide 3-kinase (PI3K). These kinases are important in signaling pathways involving receptors on the outer membrane of eukaryotic cells and are named for their catalytic subunit. The encoded protein is the catalytic subunit for PI3Kbeta (PI3KB). PI3KB has been shown to be part of the activation pathway in neutrophils which have bound immune complexes at sites of injury or infection. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice