MyD88 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A0980
Zusätzliche Namen:: IMD68|MyD88|MYD88D|WM1
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 33 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: GAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEK
Uniprot:: Q99836
Synonyme:: IMD68;mutant myeloid differentiation primary response 88;MYD88D;myeloid differentiation primary response 88;myeloid differentiation primary response gene (88);myeloid differentiation primary response protein MyD88
Weitere Details:: This gene encodes a cytosolic adapter protein that plays a central role in the innate and adaptive immune response. This protein functions as an essential signal transducer in the interleukin-1 and Toll-like receptor signaling pathways. These pathways regulate that activation of numerous proinflammatory genes. The encoded protein consists of an N-terminal death domain and a C-terminal Toll-interleukin1 receptor domain. Patients with defects in this gene have an increased susceptibility to pyogenic bacterial infections. Alternate splicing results in multiple transcript variants.