A0975
[KO Validated] Rap1A Rabbit polyclonal antibody

Größe
Auf Anfrage
- SKU:
- A0975
- Zusätzliche Namen:
- 1A|C21KG|G-22K|KREV-1|KREV1|RAP1|SMGP21
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 21kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- SYRKQVEVDCQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTEDVPMILVGNKCDLEDERVVGKEQGQNLARQW
- Uniprot:
- P62834
- Synonyme:
- C21KG;G-22K;GTP-binding protein smg p21A;KREV-1;KREV1;RAP1;Ras-related protein Krev-1;ras-related protein Rap-1A;SMGP21
- Weitere Details:
- This gene encodes a member of the Ras family of small GTPases. The encoded protein undergoes a change in conformational state and activity, depending on whether it is bound to GTP or GDP. This protein is activated by several types of guanine nucleotide exchange factors (GEFs), and inactivated by two groups of GTPase-activating proteins (GAPs). The activation status of the encoded protein is therefore affected by the balance of intracellular levels of GEFs and GAPs. The encoded protein regulates signaling pathways that affect cell proliferation and adhesion, and may play a role in tumor malignancy. Pseudogenes of this gene have been defined on chromosomes 14 and 17. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice
![[KO Validated] Rap1A Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A0975/A0975_1.jpg)
![[KO Validated] Rap1A Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A0975/A0975_2.jpg)
![[KO Validated] Rap1A Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A0975/A0975_3.jpg)
![[KO Validated] Rap1A Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A0975/A0975_4.jpg)
![[KO Validated] Rap1A Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A0975/A0975_5.jpg)
![[KO Validated] Rap1A Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A0975/A0975_Q2150_WB_01.jpg)
![[KO Validated] Rap1A Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A0975/A0975_Q2150_KO-WB_01.jpg)
![[KO Validated] Rap1A Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A0975/A0975_Q2149_IHC_02.jpg)
![[KO Validated] Rap1A Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A0975/A0975_Q2149_IHC_01.jpg)