SFPQ Rabbit polyclonal antibody

Größe

£152.00

SKU:: A0958
Zusätzliche Namen:: POMP100|PPP1R140|PSF|SFPQ
Anwendung:: ELISA, WB, IHC-P, IF, ICC, IP
Molekulargewicht:: 115kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MMIRQREMEEQMRRQREESYSRMGYMDPRERDMRMGGGGAMNMGDPYGSGGQKFPPLGGGGGIGYEANPGVPPATMSGSMMGSDMRTERFGQGGAGPVGGQGPRGMGPGTPAGYGRGREEYEGPNKKPRF
Uniprot:: P23246
Synonyme:: 100 kDa DNA-pairing protein;DNA-binding p52/p100 complex, 100 kDa subunit;epididymis secretory sperm binding protein;polypyrimidine tract binding protein associated;polypyrimidine tract-binding protein-associated splicing factor;Polypyrimidine tract-binding protein-associated-splicing factor;POMP100;PPP1R140;protein phosphatase 1, regulatory subunit 140;PSF;PTB-associated splicing factor;splicing factor proline/glutamine rich (polypyrimidine tract binding protein associated);splicing factor proline/glutamine-rich;splicing factor, proline- and glutamine-rich
Weitere Details:: Enables DNA binding activity; histone deacetylase binding activity; and protein homodimerization activity. Involved in several processes, including alternative mRNA splicing, via spliceosome; positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway; and regulation of transcription by RNA polymerase II. Acts upstream of or within double-strand break repair via homologous recombination. Located in chromatin; nuclear matrix; and paraspeckles.

Versandbedingungen:: Blue Ice