Olig1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A0953
Zusätzliche Namen:: BHLHB6|BHLHE21|Olig1
Anwendung:: ELISA, WB
Molekulargewicht:: 27kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: RRALGEGAGPAAPRLLLAGLPLLAAAPGSVLLAPGAVGPPDALRPAKYLSLALDEPPCGQFALPGGGAGGPGLCTCAVCKFPHLVPASLGLAAVQAQFSK
Uniprot:: Q8TAK6
Synonyme:: basic domain, helix-loop-helix protein, class B, 6;BHLHB6;BHLHE21;class B basic helix-loop-helix protein 6;class E basic helix-loop-helix protein 21;oligo1;oligodendrocyte lineage transcription factor 1;oligodendrocyte transcription factor 1;oligodendrocyte-specific bHLH transcription factor 1
Weitere Details:: Predicted to enable DNA-binding transcription factor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to be involved in neuron differentiation and regulation of transcription by RNA polymerase II. Predicted to act upstream of or within neuron fate commitment. Predicted to be part of chromatin. Predicted to be active in nucleus.