VPS24 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A0941
Zusätzliche Namen:: CGI-149|NEDF|VPS24
Anwendung:: ELISA, WB
Molekulargewicht:: 29kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: KEMIRSRKAVSKLYASKAHMNSVLMGMKNQLAVLRVAGSLQKSTEVMKAMQSLVKIPEIQATMRELSKEMMKAGIIEEMLEDTFESMDDQEEMEEEAEMEIDRILFEITAGALGKAPSKVTDALPEPEPPGAMAASEDEEEEEEALEAMQSRLATL
Uniprot:: Q9Y3E7
Synonyme:: 25.1 protein;CGI-149;CGI149;charged multivesicular body protein 3;CHMP family, member 3;CHMP3;chromatin-modifying protein 3;hVps24;NEDF;neuroendocrine differentiation factor;RNF103-CHMP3 protein;RNF103-CHMP3 read-through;RNF103-VPS24;RNF103-VPS24 readthrough;vacuolar protein sorting 24 homolog;vacuolar protein sorting-associated protein 24;VPS24
Weitere Details:: This gene encodes a protein that sorts transmembrane proteins into lysosomes/vacuoles via the multivesicular body (MVB) pathway. This protein, along with other soluble coiled-coil containing proteins, forms part of the ESCRT-III protein complex that binds to the endosomal membrane and recruits additional cofactors for protein sorting into the MVB. This protein may also co-immunoprecipitate with a member of the IFG-binding protein superfamily. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the upstream ring finger protein 103 (RNF103) gene.

Versandbedingungen:: Blue Ice