A0941
VPS24 Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A0941
- Zusätzliche Namen:
- CGI-149|NEDF|VPS24
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 29kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- KEMIRSRKAVSKLYASKAHMNSVLMGMKNQLAVLRVAGSLQKSTEVMKAMQSLVKIPEIQATMRELSKEMMKAGIIEEMLEDTFESMDDQEEMEEEAEMEIDRILFEITAGALGKAPSKVTDALPEPEPPGAMAASEDEEEEEEALEAMQSRLATL
- Uniprot:
- Q9Y3E7
- Synonyme:
- 25.1 protein;CGI-149;CGI149;charged multivesicular body protein 3;CHMP family, member 3;CHMP3;chromatin-modifying protein 3;hVps24;NEDF;neuroendocrine differentiation factor;RNF103-CHMP3 protein;RNF103-CHMP3 read-through;RNF103-VPS24;RNF103-VPS24 readthrough;vacuolar protein sorting 24 homolog;vacuolar protein sorting-associated protein 24;VPS24
- Weitere Details:
- This gene encodes a protein that sorts transmembrane proteins into lysosomes/vacuoles via the multivesicular body (MVB) pathway. This protein, along with other soluble coiled-coil containing proteins, forms part of the ESCRT-III protein complex that binds to the endosomal membrane and recruits additional cofactors for protein sorting into the MVB. This protein may also co-immunoprecipitate with a member of the IFG-binding protein superfamily. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the upstream ring finger protein 103 (RNF103) gene.
- Versandbedingungen:
- Blue Ice

