A0937
HFE Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A0937
- Zusätzliche Namen:
- HFE|HFE1|HH|HLA-H|MVCD7|TFQTL2
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 45kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- KEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEPSPSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE
- Uniprot:
- Q30201
- Synonyme:
- hereditary hemochromatosis protein;hereditary hemochromatosis protein HLA-H;HFE1;HH;high Fe;HLA-H;MHC class I-like protein HFE;MVCD7;TFQTL2
- Weitere Details:
- The protein encoded by this gene is a membrane protein that is similar to MHC class I-type proteins and associates with beta2-microglobulin (beta2M). It is thought that this protein functions to regulate iron absorption by regulating the interaction of the transferrin receptor with transferrin. The iron storage disorder, hereditary haemochromatosis, is a recessive genetic disorder that results from defects in this gene.
- Versandbedingungen:
- Blue Ice