IKKG Gamma Rabbit polyclonal antibody

Größe

£152.00

SKU:: A0917
Zusätzliche Namen:: AMCBX1|EDAID1|FIP-3|FIP3|Fip3p|IKK-gamma|IKKAP1|IKKG|IKKG Gamma|IMD33|IP|IP1|IP2|IPD2|NEMO|SAIDX|ZC2HC9
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 48 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: VGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPE
Uniprot:: Q9Y6K9
Synonyme:: 14.7K (adenovirus E3 protein) interacting protein 3;AMCBX1;EDAID1;FIP-3;FIP3;Fip3p;I-kappa-B kinase subunit gamma;ikB kinase subunit gamma;ikB kinase-associated protein 1;IKK-gamma;IKKAP1;IKKG;IMD33;incontinentia pigmenti;inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma;inhibitor of nuclear factor kappa B kinase subunit gamma;Inhibitor of nuclear factor kappa-B kinase subunit gamma;IP;IP1;IP2;IPD2;NEMO;NF-kappa-B essential modifier;NF-kappa-B essential modulator;ZC2HC9
Weitere Details:: This gene encodes the regulatory subunit of the inhibitor of kappaB kinase (IKK) complex, which activates NF-kappaB resulting in activation of genes involved in inflammation, immunity, cell survival, and other pathways. Mutations in this gene result in incontinentia pigmenti, hypohidrotic ectodermal dysplasia, and several other types of immunodeficiencies. A pseudogene highly similar to this locus is located in an adjacent region of the X chromosome.

Versandbedingungen:: Blue Ice