A0901
ILK Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A0901
- Zusätzliche Namen:
- HEL-S-28|ILK|ILK-1|ILK-2|P59|p59ILK
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 48kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECPRLRIFSHPNVLPVLGACQSP
- Uniprot:
- Q13418
- Synonyme:
- 59 kDa serine/threonine-protein kinase;beta-integrin-linked kinase;epididymis secretory protein Li 28;HEL-S-28;ILK-1;ILK-2;integrin-linked kinase-2;integrin-linked protein kinase;P59;p59ILK
- Weitere Details:
- This gene encodes a protein with a kinase-like domain and four ankyrin-like repeats. The encoded protein associates at the cell membrane with the cytoplasmic domain of beta integrins, where it regulates integrin-mediated signal transduction. Activity of this protein is important in the epithelial to mesenchymal transition, and over-expression of this gene is implicated in tumor growth and metastasis. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice





