A0894
PRKCSH Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A0894
- Zusätzliche Namen:
- AGE-R2|G19P1|GIIB|PCLD|PCLD1|PKCSH|PLD1|PRKCSH|VASAP-60
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 80kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- PFKLVSQKPKLGGSPTSLGTWGSWIGPDHDKFSAMKYEQGTGCWQGPNRSTTVRLLCGKETMVTSTTEPSRCEYLMELMTPAACPEPPPEAPTEDDHDEL
- Uniprot:
- P14314
- Synonyme:
- 80K-H protein;advanced glycation end-product receptor 2;AGE-binding receptor 2;AGE-R2;G19P1;GIIB;glucosidase 2 subunit beta;glucosidase II subunit beta;hepatocystin;PCLD;PCLD1;PKCSH;PLD1;protein kinase C substrate 60.1 kDa protein heavy chain;protein kinase C substrate, 80 Kda protein;VASAP-60
- Weitere Details:
- This gene encodes the beta-subunit of glucosidase II, an N-linked glycan-processing enzyme in the endoplasmic reticulum. The encoded protein is an acidic phosphoprotein known to be a substrate for protein kinase C. Mutations in this gene have been associated with the autosomal dominant polycystic liver disease. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice

