A0891
SAE1 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A0891
- Zusätzliche Namen:
- AOS1|HSPC140|SAE1|SUA1|UBLE1A
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 40kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- DSSETTMVKKKVVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSLGISPDLLPEDFVRYCFSEMA
- Uniprot:
- Q9UBE0
- Synonyme:
- activator of SUMO1;AOS1;HSPC140;sentrin/SUMO-activating protein AOS1;SUA1;SUMO-1 activating enzyme E1 N subunit;SUMO-1 activating enzyme subunit 1;SUMO-activating enzyme subunit 1;ubiquitin-like 1-activating enzyme E1A;ubiquitin-like protein SUMO-1 activating enzyme;UBLE1A
- Weitere Details:
- Posttranslational modification of proteins by the addition of the small protein SUMO (see SUMO1; MIM 601912), or sumoylation, regulates protein structure and intracellular localization. SAE1 and UBA2 (MIM 613295) form a heterodimer that functions as a SUMO-activating enzyme for the sumoylation of proteins (Okuma et al., 1999 [PubMed 9920803]).
- Versandbedingungen:
- Blue Ice