A0881
EIF4G1 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A0881
- Zusätzliche Namen:
- EIF-4G1|EIF4F|EIF4G|EIF4G1|EIF4GI|P220|PARK18
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 250kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- AGSNPGPESEGSGVPPRPEEADETWDSKEDKIHNAENIQPGEQKYEYKSDQWKPLNLEEKKRYDREFLLGFQFIFASMQKPEGLPHISDVVLDKANKTPLR
- Uniprot:
- Q04637
- Synonyme:
- eIF-4-gamma 1;EIF-4G1;EIF4-gamma;EIF4F;EIF4G;EIF4GI;eucaryotic translation initiation factor 4G;eukaryotic translation initiation factor 4 gamma 1;P220;PARK18
- Weitere Details:
- The protein encoded by this gene is a component of the multi-subunit protein complex EIF4F. This complex facilitates the recruitment of mRNA to the ribosome, which is a rate-limiting step during the initiation phase of protein synthesis. The recognition of the mRNA cap and the ATP-dependent unwinding of 5'-terminal secondary structure is catalyzed by factors in this complex. The subunit encoded by this gene is a large scaffolding protein that contains binding sites for other members of the EIF4F complex. A domain at its N-terminus can also interact with the poly(A)-binding protein, which may mediate the circularization of mRNA during translation. Alternative splicing results in multiple transcript variants, some of which are derived from alternative promoter usage.
- Versandbedingungen:
- Blue Ice

