A0871
Islet1 Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A0871
- Zusätzliche Namen:
- Isl-1|ISLET1
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 39-45 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- YAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKRSIMMKQLQQQQPNDKTNIQGMTGTPMVAASPERHDGGLQANPVEVQSYQPPWKVLSDFALQ
- Uniprot:
- P61371
- Synonyme:
- insulin gene enhancer protein ISL-1;Isl-1;islet-1;ISLET1
- Weitere Details:
- This gene encodes a member of the LIM/homeodomain family of transcription factors. The encoded protein binds to the enhancer region of the insulin gene, among others, and may play an important role in regulating insulin gene expression. The encoded protein is central to the development of pancreatic cell lineages and may also be required for motor neuron generation. Mutations in this gene have been associated with maturity-onset diabetes of the young.
- Versandbedingungen:
- Blue Ice



