A0865
RGMA Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A0865
- Zusätzliche Namen:
- RGM|RGMA
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 60 kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- TAPETFPYETAVAKCKEKLPVEDLYYQACVFDLLTTGDVNFTLAAYYALEDVKMLHSNKDKLHLYERTRDLPGRAAAGLPLAPRPLLGALVPLLALLPVFC
- Uniprot:
- Q96B86
- Synonyme:
- repulsive guidance molecule A;repulsive guidance molecule family member a;RGM;RGM domain family member A;RGM domain family, member A
- Weitere Details:
- This gene encodes a member of the repulsive guidance molecule family. The encoded protein is a glycosylphosphatidylinositol-anchored glycoprotein that functions as an axon guidance protein in the developing and adult central nervous system. This protein may also function as a tumor suppressor in some cancers. Alternate splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice