A0796
SBDS Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A0796
- Zusätzliche Namen:
- CGI-97|SBDS|SDO1|SDS|SWDS
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 29kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- KQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLIKVIESEDYGQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE
- Uniprot:
- Q9Y3A5
- Synonyme:
- CGI-97;ribosome maturation protein SBDS;SBDS, ribosome assembly guanine nucleotide exchange factor;SDO1;SDS;Shwachman-Bodian-Diamond syndrome protein;SWDS
- Weitere Details:
- This gene encodes a highly conserved protein that plays an essential role in ribosome biogenesis. The encoded protein interacts with elongation factor-like GTPase 1 to disassociate eukaryotic initiation factor 6 from the late cytoplasmic pre-60S ribosomal subunit allowing assembly of the 80S subunit. Mutations within this gene are associated with the autosomal recessive disorder Shwachman-Bodian-Diamond syndrome. This gene has a closely linked pseudogene that is distally located.
- Versandbedingungen:
- Blue Ice