Erlin-2 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A0781
Zusätzliche Namen:: C8orf2|Erlin-2|NET32|SPFH2|SPG18
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 43kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: HLMLPFITSYKSVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKIHHELNQFCSVHTLQEVYIELFDQIDENLKL
Uniprot:: O94905
Synonyme:: C8orf2;endoplasmic reticulum lipid raft-associated protein 2;epididymis secretory sperm binding protein;erlin-2;NET32;spastic paraplegia 18 (autosomal dominant);SPFH domain family, member 2;SPFH2;SPG18;stomatin-prohibitin-flotillin-HflC/K domain-containing protein 2
Weitere Details:: This gene encodes a member of the SPFH domain-containing family of lipid raft-associated proteins. The encoded protein is localized to lipid rafts of the endoplasmic reticulum and plays a critical role in inositol 1,4,5-trisphosphate (IP3) signaling by mediating ER-associated degradation of activated IP3 receptors. Mutations in this gene are a cause of spastic paraplegia-18 (SPG18). Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.