A0768
BRMS1 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A0768
- Zusätzliche Namen:
- breast cancer metastasis-suppressor 1|BRMS1
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 28kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MPVQPPSKDTEEMEAEGDSAAEMNGEEEESEEERSGSQTESEEESSEMDDEDYERRRSECVSEMLDLEKQFSELKEKLFRERLSQLRLRLEEVGAERAPE
- Uniprot:
- Q9HCU9
- Synonyme:
- breast cancer metastasis suppressor 1;breast cancer metastasis-suppressor 1
- Weitere Details:
- This gene reduces the metastatic potential, but not the tumorogenicity, of human breast cancer and melanoma cell lines. The protein encoded by this gene localizes primarily to the nucleus and is a component of the mSin3a family of histone deacetylase complexes (HDAC). The protein contains two coiled-coil motifs and several imperfect leucine zipper motifs. Alternative splicing results in two transcript variants encoding different isoforms.
- Versandbedingungen:
- Blue Ice