[KD Validated] NF2 Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A0739
Zusätzliche Namen:: ACN|BANF|F2|merlin-1|SCH
Anwendung:: ELISA, WB, IF, ICC, IP
Molekulargewicht:: 73kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: TKPTYPPMNPIPAPLPPDIPSFNLIGDSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLNELKTEIEALKLKERETALDILHNENSDRGGSSKHNT
Uniprot:: P35240
Synonyme:: ACN;BANF;bilateral acoustic neurofibromatosis;merlin;merlin-1;moesin-ezrin-radixin like;moesin-ezrin-radixin-like protein;moesin-ezrin-radizin-like protein;neurofibromin 2 (bilateral acoustic neuroma);Neurofibromin-2;SCH;schwannomerlin;schwannomin
Weitere Details:: This gene encodes a protein that is similar to some members of the ERM (ezrin, radixin, moesin) family of proteins that link cytoskeletal components with proteins in the cell membrane. The encoded protein is involved in regulation of contact-dependent inhibition of cell proliferation and functions in cell-cell adhesion and transmembrane signaling. The encoded protein has been shown to interact with cell-surface proteins, proteins involved in cytoskeletal dynamics, and proteins involved in regulating ion transport. Disruption of this protein's function has been implicated in tumorigenesis and metastasis. Mutations in this gene are associated with neurofibromatosis type II which is characterized by nervous system and skin tumors and ocular abnormalities.

Versandbedingungen:: Blue Ice