VE-Cadherin Rabbit PolymAb[R]

Größe

Auf Anfrage

SKU:: A0734PM
Zusätzliche Namen:: 7B4|CD144
Anwendung:: ELISA, WB, IHC-P, IF
Molekulargewicht:: 90 kDa,120-140 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: TQTKYTFVVPEDTRVGTSVGSLFVEDPDEPQNRMTKYSILRGDYQDAFTIETNPAHNEGIIKPMKPLDYEYIQQYSFIVEATDPTIDLRYMSPPAGNRAQ
Uniprot:: P33151, P55284
Synonyme:: 7B4;7B4 antigen;7B4/cadherin-5;AA408225;cadherin 5, type 2 (vascular endothelium);cadherin 5, type 2, VE-cadherin (vascular epithelium);cadherin-5;CD144;cd144 antigen;endothelial-specific cadherin;vascular endothelial cadherin;VE;VE-C;VE-Cad;VE-cadherin;Vec;VEcad;VECD
Weitere Details:: This gene encodes a classical cadherin of the cadherin superfamily. The encoded preproprotein is proteolytically processed to generate the mature glycoprotein. This calcium-dependent cell-cell adhesion molecule is comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Functioning as a classical cadherin by imparting to cells the ability to adhere in a homophilic manner, this protein plays a role in endothelial adherens junction assembly and maintenance. This gene is located in a gene cluster in a region on the long arm of chromosome 16 that is involved in loss of heterozygosity events in breast and prostate cancer.

Versandbedingungen:: Blue Ice