Tyro3 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A0730
Zusätzliche Namen:: BYK|Dtk|Etk-2|Rek|RSE|Sky|Tif|Tyro3
Anwendung:: ELISA, WB
Molekulargewicht:: 130kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: GQLSVLSASQDPLYINIERAEEPTAGGSLELPGRDQPYSGAGDGSGMGAVGGTPSDCRYILTPGGLAEQPGQAEHQPESPLNETQRLLLLQQGLLPHSSC
Uniprot:: Q06418
Synonyme:: BYK;Dtk;Etk-2;Rek;RSE;Sky;Tif;tyrosine-protein kinase byk;tyrosine-protein kinase DTK;tyrosine-protein kinase receptor TYRO3;tyrosine-protein kinase RSE;tyrosine-protein kinase SKY;tyrosine-protein kinase TIF
Weitere Details:: The gene is part of a 3-member transmembrane receptor kinase receptor family with a processed pseudogene distal on chromosome 15. The encoded protein is activated by the products of the growth arrest-specific gene 6 and protein S genes and is involved in controlling cell survival and proliferation, spermatogenesis, immunoregulation and phagocytosis. The encoded protein has also been identified as a cell entry factor for Ebola and Marburg viruses.