A0710
UBE4A Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A0710
- Zusätzliche Namen:
- E4|NEDHMS|UBE4A|UBOX2|UFD2
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 125kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MTDQENNNNISSNPFAALFGSLADAKQFAAIQKEQLKQQSDELPASPDDSDNSVSESLDEFDYSVAEISRSFRSQQEICEQLNINHMIQRIFLITLDNSD
- Uniprot:
- Q14139
- Synonyme:
- E4;RING-type E3 ubiquitin transferase E4 A;ubiquitin conjugation factor E4 A;ubiquitination factor E4A (UFD2 homolog, yeast);UBOX2;UFD2
- Weitere Details:
- This gene encodes a member of the U-box ubiquitin ligase family. The encoded protein is involved in multiubiquitin chain assembly and plays a critical role in chromosome condensation and separation through the polyubiquitination of securin. Autoantibodies against the encoded protein may be markers for scleroderma and Crohn's disease. A pseudogene of this gene is located on the long arm of chromosome 3. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
- Versandbedingungen:
- Blue Ice