ATG7 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A0691
Zusätzliche Namen:: APG7-LIKE|APG7L|ATG7|GSA7|SCAR31
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 78 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LGFDTFVVMRHGLKKPKQQGAGDLCPNHPVASADLLGSSLFANIPGYKLGCYFCNDVVAPGDSTRDRTLDQQCTVSRPGLAVIAGALAVELMVSVLQHPEGGYAIASSSDDRMNEPPTSLGLVPHQIRGFLSRFDNVLPVSLAFDKCTACSSKVLDQYEREGFNFLAKVFNSSHSFL
Uniprot:: O95352
Synonyme:: APG7 autophagy 7-like;APG7-LIKE;APG7L;ATG12-activating enzyme E1 ATG7;Autophagy-related protein 7;GSA7;hAGP7;SCAR31;ubiquitin-activating enzyme E1-like protein;ubiquitin-like modifier-activating enzyme ATG7
Weitere Details:: This gene encodes an E1-like activating enzyme that is essential for autophagy and cytoplasmic to vacuole transport. The encoded protein is also thought to modulate p53-dependent cell cycle pathways during prolonged metabolic stress. It has been associated with multiple functions, including axon membrane trafficking, axonal homeostasis, mitophagy, adipose differentiation, and hematopoietic stem cell maintenance. Alternative splicing results in multiple transcript variants.