STEAP3 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A0683
Zusätzliche Namen:: AHMIO2|dudlin-2|dudulin-2|pHyde|STEAP3|STMP3|TSAP6
Anwendung:: ELISA, WB
Molekulargewicht:: 55kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MPEEMDKPLISLHLVDSDSSLAKVPDEAPKVGILGSGDFARSLATRLVGSGFKVVVGSRNPKRTARLFPSAAQVTFQEEAVSSPEVIFVAVFREHYSSLCSLSDQLAGKILVDVSNPTEQEHLQHRESNAEYLASLFPTCTVVKAFNVISAWTLQAGPRDGNRQVPICGDQPEAKRAVSE
Uniprot:: Q658P3
Synonyme:: AHMIO2;dudlin-2;dudulin-2;metalloreductase STEAP3;pHyde;six-transmembrane epithelial antigen of prostate 3;STEAP family member 3, metalloreductase;STMP3;TSAP6;tumor suppressor pHyde;tumor suppressor-activated pathway protein 6
Weitere Details:: This gene encodes a multipass membrane protein that functions as an iron transporter. The encoded protein can reduce both iron (Fe3+) and copper (Cu2+) cations. This protein may mediate downstream responses to p53, including promoting apoptosis. Deficiency in this gene can cause anemia. Alternative splicing results in multiple transcript variants.