SMNDC1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A0681
Zusätzliche Namen:: SMNDC1|SMNR|SPF30|TDRD16C
Anwendung:: ELISA, WB
Molekulargewicht:: 27kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MSEDLAKQLASYKAQLQQVEAALSGNGENEDLLKLKKDLQEVIELTKDLLSTQPSETLASSDSFASTQPTHSWKVGDKCMAVWSEDGQCYEAEIEEIDEENGTAAITFAGYGNAEVTPLLNLKPVEEGRKAKEDSGNKPMSKKEMIAQQREYKKKKALKKAQRIKELEQEREDQKVKWQQFNNRAYSKNKKGQVKRSIFASPESVTGKVGVGTCGIADKPMTQYQDTSKYNVRHLMPQ
Uniprot:: O75940
Synonyme:: 30 kDa splicing factor SMNrp;SMN-related protein;SMNR;SPF30;splicing factor 30, survival of motor neuron-related;survival motor neuron domain-containing protein 1;survival of motor neuron-related-splicing factor 30;TDRD16C;tudor domain containing 16C
Weitere Details:: This gene is a paralog of SMN1 gene, which encodes the survival motor neuron protein, mutations in which are cause of autosomal recessive proximal spinal muscular atrophy. The protein encoded by this gene is a nuclear protein that has been identified as a constituent of the spliceosome complex. This gene is differentially expressed, with abundant levels in skeletal muscle, and may share similar cellular function as the SMN1 gene.