[KO Validated] GARS Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A0651
Zusätzliche Namen:: CMT2D|DSMAV|GARS|GlyRS|HMN5|HMN5A|RS|SMAD1|SMAJI
Anwendung:: ELISA, WB
Molekulargewicht:: 83kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: RHGVSHKVDDSSGSIGRRYARTDEIGVAFGVTIDFDTVNKTPHTATLRDRDSMRQIRAEISELPSIVQDLANGNITWADVEARYPLFEGQETGKKETIEE
Uniprot:: P41250
Synonyme:: AP-4-A synthetase;ap4A synthetase;Charcot-Marie-Tooth neuropathy 2D;Charcot-Marie-Tooth neuropathy, neuronal type, D;CMT2D;diadenosine tetraphosphate synthetase;DSMAV;GARS;glycine--tRNA ligase;Glycyl-tRNA synthetase;Glycyl-tRNA synthetase 1;GlyRS;HMN5;HMN5A;SMAD1;SMAJI
Weitere Details:: This gene encodes glycyl-tRNA synthetase, one of the aminoacyl-tRNA synthetases that charge tRNAs with their cognate amino acids. The encoded enzyme is an (alpha)2 dimer which belongs to the class II family of tRNA synthetases. It has been shown to be a target of autoantibodies in the human autoimmune diseases, polymyositis or dermatomyositis. Two transcript variants encoding different isoforms have been found for this gene.