A0609
NUDT5 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A0609
- Zusätzliche Namen:
- hNUDT5|NUDT5|YSA1|YSA1H|YSAH1
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 34kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MESQEPTESSQNGKQYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQRTLHYECIVLVKQFRPPMGGYCIEFPAGLID
- Uniprot:
- Q9UKK9
- Synonyme:
- 8-oxo-dGDP phosphatase;ADP-sugar pyrophosphatase;hNUDT5;nuclear ATP-synthesis protein NUDIX5;Nucleoside diphosphate-linked moiety X motif 5;nudix (nucleoside diphosphate linked moiety X)-type motif 5;YSA1;YSA1H;YSAH1
- Weitere Details:
- This gene belongs to the Nudix (nucleoside diphosphate linked moiety X) hydrolase superfamily. The encoded enzyme catalyzes the hydrolysis of modified nucleoside diphosphates, including ADP-ribose (ADPR) and 8-oxoGua-containing 8-oxo-dADP and 8-oxo-dGDP. Protein-bound ADP ribose can be hazardous to the cell because it can modify some amino acid residues, resulting in the inhibition of ATP-activated potassium channels. 8-oxoGua is an oxidized form of guanine that can potentially alter genetic information by pairing with adenine and cytosine in RNA. Presence of 8-oxoGua in RNA results in formation of abnormal proteins due to translational errors.
- Versandbedingungen:
- Blue Ice