A0595
DYRK1A Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A0595
- Zusätzliche Namen:
- DYRK|DYRK1|DYRK1A|HP86|MNB|MNBH|MRD7
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 70kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- LGNRTRPRVYNSPTNSSSTQDSMEVGHSHHSMTSLSSSTTSSSTSSSSTGNQGNQAYQNRPVAANTLDFGQNGAMDVNLTVYSNPRQETGIAGHPTYQFSANTGPAHYMTEGHLTMRQGADREESPMTGVCVQQSPVASS
- Uniprot:
- Q13627
- Synonyme:
- dual specificity tyrosine-(Y)-phosphorylation regulated kinase 1A;dual specificity tyrosine-phosphorylation-regulated kinase 1A;dual specificity YAK1-related kinase;DYRK;DYRK1;HP86;MNB;mnb protein kinase homolog hp86;MNB/DYRK protein kinase;MNBH;MRD7;protein kinase minibrain homolog;serine/threonine kinase MNB;serine/threonine-specific protein kinase
- Weitere Details:
- This gene encodes a member of the Dual-specificity tyrosine phosphorylation-regulated kinase (DYRK) family. This member contains a nuclear targeting signal sequence, a protein kinase domain, a leucine zipper motif, and a highly conservative 13-consecutive-histidine repeat. It catalyzes its autophosphorylation on serine/threonine and tyrosine residues. It may play a significant role in a signaling pathway regulating cell proliferation and may be involved in brain development. This gene is a homolog of Drosophila mnb (minibrain) gene and rat Dyrk gene. It is localized in the Down syndrome critical region of chromosome 21, and is considered to be a strong candidate gene for learning defects associated with Down syndrome. Alternative splicing of this gene generates several transcript variants differing from each other either in the 5' UTR or in the 3' coding region. These variants encode at least five different isoforms.
- Versandbedingungen:
- Blue Ice

