GBP1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A0570
Zusätzliche Namen:: GBP1|guanylate-binding protein 1
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 68 kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: RVKAESAQASAKMLQEMQRKNEQMMEQKERSYQEHLKQLTEKMENDRVQLLKEQERTLALKLQEQEQLLKEGFQKESRIMKNEIQDLQTKMRRRKACTIS
Uniprot:: P32455
Synonyme:: GBP-1;GTP-binding protein 1;guanine nucleotide-binding protein 1;guanylate binding protein 1, interferon-inducible, 67kDa;guanylate-binding protein 1;huGBP-1;interferon-induced guanylate-binding protein 1
Weitere Details:: Guanylate binding protein expression is induced by interferon. Guanylate binding proteins are characterized by their ability to specifically bind guanine nucleotides (GMP, GDP, and GTP) and are distinguished from the GTP-binding proteins by the presence of 2 binding motifs rather than 3.