A0552
NEDD4 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A0552
- Zusätzliche Namen:
- NEDD4|NEDD4-1|RPF1
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 120kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- GSYSSNGSDFGSCASITSGGSYTNSVISDSSSYTFPPSDDTFLGGNLPSDSTSNRSVPNRNTTPCEIFSRSTSTDPFVQDDLEHGLEIMKLPVSRNTKIPLKRYSSLVIFPRSPSTTRPTSPTSLCTLLSKGSYQTSHQFIISPSEIAHNEDGTSAKGFLSTAVNGLRLSKTICTPGEVRDIRPLHRKGSLQKKIVLSNNTPRQTVCEKSSEGYSCVSVHFTQRKAATLDCETTNGDCKPEMSEIKLNSDSEYIKLMHRTSACLPSSQNVDCQININGELERPHSQMNKNHGILRRSISLG
- Uniprot:
- P46934
- Synonyme:
- cell proliferation-inducing gene 53 protein;E3 ubiquitin-protein ligase NEDD4;HECT-type E3 ubiquitin transferase NEDD4;NEDD4-1;Neural precursor cell expressed developmentally down-regulated protein 4;neural precursor cell expressed, developmentally down-regulated 4, E3 ubiquitin protein ligase;receptor-potentiating factor 1;RPF1
- Weitere Details:
- This gene is the founding member of the NEDD4 family of HECT ubiquitin ligases that function in the ubiquitin proteasome system of protein degradation. The encoded protein contains an N-terminal calcium and phospholipid binding C2 domain followed by multiple tryptophan-rich WW domains and, a C-terminal HECT ubiquitin ligase catalytic domain. It plays critical role in the regulation of a number of membrane receptors, endocytic machinery components and the tumor suppressor PTEN.
- Versandbedingungen:
- Blue Ice





