A0503
UBE2B Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A0503
- Zusätzliche Namen:
- E2-17kDa|HHR6B|HR6B|RAD6B|UBC2|UBE2B
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 17kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- FKLVIEFSEEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKRVSAIVEQSWNDS
- Uniprot:
- P63146
- Synonyme:
- E2 protein;E2 ubiquitin-conjugating enzyme B;E2-17kDa;HHR6B;HR6B;RAD6 homolog B;RAD6B;UBC2;ubiquitin carrier protein B;ubiquitin conjugating enzyme E2B;ubiquitin-conjugating enzyme E2 B;ubiquitin-conjugating enzyme E2-17 kDa;ubiquitin-conjugating enzyme E2B (RAD6 homolog);ubiquitin-protein ligase B
- Weitere Details:
- The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is required for post-replicative DNA damage repair. Its protein sequence is 100% identical to the mouse, rat, and rabbit homologs, which indicates that this enzyme is highly conserved in eukaryotic evolution.
- Versandbedingungen:
- Blue Ice








