EXOSC7 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A0501
Zusätzliche Namen:: EAP1|EXOSC7|hRrp42p|p8|RRP42|Rrp42p
Anwendung:: ELISA, WB
Molekulargewicht:: 37kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MASVTLSEAEKVYIVHGVQEDLRVDGRGCEDYRCVEVETDVVSNTSGSARVKLGHTDILVGVKAEMGTPKLEKPNEGYLEFFVDCSASATPEFEGRGGDD
Uniprot:: Q15024
Synonyme:: EAP1;exosome complex component RRP42;exosome complex exonuclease RRP42;Exosome component 7;hRrp42p;p8;ribosomal RNA-processing protein 42;RRP42;Rrp42p
Weitere Details:: Predicted to enable 3'-5'-exoribonuclease activity and RNA binding activity. Predicted to be involved in RNA metabolic process. Part of exosome (RNase complex).