CARS Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A0438
Zusätzliche Namen:: CARS|CYSRS|MCDDBH|MDBH|MGC:11246
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 85kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: EREEKRRVEEEKRKKKEEAARRKQEQEAAKLAKMKIPPSEMFLSETDKYSKFDENGLPTHDMEGKELSKGQAKKLKKLFEAQEKLYKEYLQMAQNGSFQ
Uniprot:: P49589
Synonyme:: CARS;CYSRS;cysteine translase;cysteine tRNA ligase 1, cytoplasmic;cysteine--tRNA ligase, cytoplasmic;Cysteinyl-tRNA synthetase;MCDDBH;MDBH;MGC:11246
Weitere Details:: This gene encodes a class 1 aminoacyl-tRNA synthetase, cysteinyl-tRNA synthetase. Each of the twenty aminoacyl-tRNA synthetases catalyzes the aminoacylation of a specific tRNA or tRNA isoaccepting family with the cognate amino acid. This gene is one of several located near the imprinted gene domain on chromosome 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian and breast cancers. Alternative splicing of this gene results in multiple transcript variants.