MCL1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A0434
Zusätzliche Namen:: bcl2-L-3|BCL2L3|EAT|Mcl-1|MCL1|MCL1-ES|mcl1/EAT|MCL1L|MCL1S|TM
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 35kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGG
Uniprot:: Q07820
Synonyme:: bcl-2-like protein 3;bcl-2-related protein EAT/mcl1;BCL2 family apoptosis regulator;bcl2-L-3;BCL2L3;EAT;induced myeloid leukemia cell differentiation protein Mcl-1;Mcl-1;MCL1-ES;MCL1, BCL2 family apoptosis regulator;mcl1/EAT;MCL1L;MCL1S;myeloid cell leukemia 1;myeloid cell leukemia ES;myeloid cell leukemia sequence 1 (BCL2-related);TM
Weitere Details:: This gene encodes an anti-apoptotic protein, which is a member of the Bcl-2 family. Alternative splicing results in multiple transcript variants. The longest gene product (isoform 1) enhances cell survival by inhibiting apoptosis while the alternatively spliced shorter gene products (isoform 2 and isoform 3) promote apoptosis and are death-inducing.

Versandbedingungen:: Blue Ice