ACHA4 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A0350
Zusätzliche Namen:: ACHA4|BFNC|EBN|EBN1|NACHR|NACHRA4|NACRA4
Anwendung:: ELISA, WB
Molekulargewicht:: 70kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: PEADGQAAGALASRNTHSAELPPPDQPSPCKCTCKKEPSSVSPSATVKTRSTKAPPPHLPLSPALTRAVEGVQYIADHLKAEDTDFSVKEDWKYVAMVIDR
Uniprot:: P43681
Synonyme:: BFNC;cholinergic receptor, nicotinic alpha 4;cholinergic receptor, nicotinic, alpha 4 (neuronal);cholinergic receptor, nicotinic, alpha polypeptide 4;EBN;EBN1;NACHR;NACHRA4;NACRA4;neuronal acetylcholine receptor subunit alpha-4;neuronal nicotinic acetylcholine receptor alpha-4 subunit
Weitere Details:: This gene encodes a nicotinic acetylcholine receptor, which belongs to a superfamily of ligand-gated ion channels that play a role in fast signal transmission at synapses. These pentameric receptors can bind acetylcholine, which causes an extensive change in conformation that leads to the opening of an ion-conducting channel across the plasma membrane. This protein is an integral membrane receptor subunit that can interact with either nAChR beta-2 or nAChR beta-4 to form a functional receptor. Mutations in this gene cause nocturnal frontal lobe epilepsy type 1. Polymorphisms in this gene that provide protection against nicotine addiction have been described. Alternative splicing results in multiple transcript variants.

Versandbedingungen:: Blue Ice