PBRM1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A0334
Zusätzliche Namen:: BAF180|PB1|PBRM1|RCC|SMARCH1
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 200 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: VLEAREPGSGRRLCDLFMVKPSKKDYPDYYKIILEPMDLKIIEHNIRNDKYAGEEGMIEDMKLMFRNARHYNEEGSQVYNDAHILEKLLKEKRKELGPLPDDDDMASPKLKLSRKSGISPKKSKYMTPMQQKLNEVYEAVKNYTDKRGRRL
Uniprot:: Q86U86
Synonyme:: BAF180;BRG1-associated factor 180;PB1;polybromo-1D;protein polybromo-1;RCC;SMARCH1
Weitere Details:: This locus encodes a subunit of ATP-dependent chromatin-remodeling complexes. The encoded protein has been identified as in integral component of complexes necessary for ligand-dependent transcriptional activation by nuclear hormone receptors. Mutations at this locus have been associated with primary clear cell renal cell carcinoma.